SCOP 1.55: Domain d1maeh_: 1mae H:

Lineage for d1maeh_ (1mae H:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)

4. Superfamily b.69.2: Methylamine dehydrogenase, H-chain [50969] (1 family)

5. Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
   this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain

6. Protein Methylamine dehydrogenase, H-chain [50971] (2 species)

7. Species Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId:34007] [50973] (3 PDB entries)

8. Domain d1maeh_: 1mae H: [27641]
   Other proteins in same PDB: d1mael_

Details for d1maeh_

PDB Entry: 1mae, 2.8 Å

PDB Description: The Active Site Structure of Methylamine Dehydrogenase: Hydrazines Identify C6 as the Reactive Site of the Tryptophan Derived Quinone Cofactor

SCOP Domain Sequences for d1maeh_:

Sequence; same for both SEQRES and ATOM records:

>d1maeh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus)}
ssasaaaaaaaaalaagaadgptndeapgadgrrsyinlpahhsaiiqqwvldagsgsil
ghvnggflpnpvaahsgsefalastsfsriakgkrtdyvevfdpvtflpiadielpdapr
fdvgpyswmnantpnnadllffqfaagpavglvvqggssddqllssptcyhihpgapstf
yllcaqgglaktdhaggaagaglvgamltaaqnlltqpaqanksgrivwpvysgkilqad
isaagatnkapidalsggrkadtwrpggwqqvaylkssdgiylltseqsawklhaaakev
tsvtglvgqtssqislghdvdaisvaqdggpdlyalsagtevlhiydagagdqdqstvel
gsgpqvlsvmnea

Timeline for d1maeh_:

• d1maeh_ appears in SCOP 1.57
  
• d1maeh_ appears in the current release, SCOPe 2.08