Lineage for d1maeh_ (1mae H:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17159Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)
  4. 17167Superfamily b.69.2: Methylamine dehydrogenase, H-chain [50969] (1 family) (S)
  5. 17168Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain
  6. 17169Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 17170Species Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId:34007] [50973] (3 PDB entries)
  8. 17173Domain d1maeh_: 1mae H: [27641]
    Other proteins in same PDB: d1mael_

Details for d1maeh_

PDB Entry: 1mae (more details), 2.8 Å

PDB Description: The Active Site Structure of Methylamine Dehydrogenase: Hydrazines Identify C6 as the Reactive Site of the Tryptophan Derived Quinone Cofactor

SCOP Domain Sequences for d1maeh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1maeh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus)}
ssasaaaaaaaaalaagaadgptndeapgadgrrsyinlpahhsaiiqqwvldagsgsil
ghvnggflpnpvaahsgsefalastsfsriakgkrtdyvevfdpvtflpiadielpdapr
fdvgpyswmnantpnnadllffqfaagpavglvvqggssddqllssptcyhihpgapstf
yllcaqgglaktdhaggaagaglvgamltaaqnlltqpaqanksgrivwpvysgkilqad
isaagatnkapidalsggrkadtwrpggwqqvaylkssdgiylltseqsawklhaaakev
tsvtglvgqtssqislghdvdaisvaqdggpdlyalsagtevlhiydagagdqdqstvel
gsgpqvlsvmnea

SCOP Domain Coordinates for d1maeh_:

Click to download the PDB-style file with coordinates for d1maeh_.
(The format of our PDB-style files is described here.)

Timeline for d1maeh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mael_