Lineage for d4ygah_ (4yga H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761643Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries)
  8. 2761675Domain d4ygah_: 4yga H: [276402]
    automated match to d1mqkh_
    complexed with ca

Details for d4ygah_

PDB Entry: 4yga (more details), 2.94 Å

PDB Description: cdpk1, from toxoplasma gondii, bound to inhibitory vhh-1b7
PDB Compounds: (H:) vhh-1b7

SCOPe Domain Sequences for d4ygah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ygah_ b.1.1.0 (H:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvetggglvqpgeslrlscvasgftldhsavgwfrqvpgkerekllcinangvsldy
adsikgrftisrdnakntvylqmndlkpedtatyscaatrefcsayvflyehwgqgtqvt
vss

SCOPe Domain Coordinates for d4ygah_:

Click to download the PDB-style file with coordinates for d4ygah_.
(The format of our PDB-style files is described here.)

Timeline for d4ygah_: