SCOPe 2.07: Domain d4ymla_: 4yml A:

Lineage for d4ymla_ (4yml A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (45 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [276399] (1 PDB entry)

8. Domain d4ymla_: 4yml A: [276400]
   automated match to d4qezb_
   complexed with 4f0, po4

Details for d4ymla_

PDB Entry: 4yml, 1.75 Å

PDB Description: crystal structure of escherichia coli 5'-methylthioadenosine/s- adenosyl homocysteine nucleosidase (mtan) complexed with (3s,4r)- methylthio-dadme-immucillin-a

PDB Compounds: (A:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4ymla_:

Sequence; same for both SEQRES and ATOM records:

>d4ymla_ c.56.2.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklah

Timeline for d4ymla_:

• d4ymla_ first appeared in SCOPe 2.05
  
• d4ymla_ appears in SCOPe 2.06
  
• d4ymla_ appears in the current release, SCOPe 2.08