SCOP 1.75: Domain d1mafh_: 1maf H:

Lineage for d1mafh_ (1maf H:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families)

5. Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
   less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
   this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain

6. Protein Methylamine dehydrogenase, H-chain [50971] (2 species)

7. Species Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId:34007] [50973] (3 PDB entries)

8. Domain d1mafh_: 1maf H: [27640]
   Other proteins in same PDB: d1mafl_
   complexed with qtr, tfh

Details for d1mafh_

PDB Entry: 1maf, 2.6 Å

PDB Description: The Active Site Structure of Methylamine Dehydrogenase: Hydrazines Identify C6 as the Reactive Site of the Tryptophan Derived Quinone Cofactor

PDB Compounds: (H:) methylamine dehydrogenase (heavy subunit)

SCOP Domain Sequences for d1mafh_:

Sequence; same for both SEQRES and ATOM records:

>d1mafh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}
ssasaaaaaaaaalaagaadgptndeapgadgrrsyinlpahhsaiiqqwvldagsgsil
ghvnggflpnpvaahsgsefalastsfsriakgkrtdyvevfdpvtflpiadielpdapr
fdvgpyswmnantpnnadllffqfaagpavglvvqggssddqllssptcyhihpgapstf
yllcaqgglaktdhaggaagaglvgamltaaqnlltqpaqanksgrivwpvysgkilqad
isaagatnkapidalsggrkadtwrpggwqqvaylkssdgiylltseqsawklhaaakev
tsvtglvgqtssqislghdvdaisvaqdggpdlyalsagtevlhiydagagdqdqstvel
gsgpqvlsvmnea

Timeline for d1mafh_:

• d1mafh_ first appeared (with stable ids) in SCOP 1.55
  
• d1mafh_ appears in SCOP 1.73
  
• d1mafh_ appears in SCOPe 2.01
  
• d1mafh_ appears in the current release, SCOPe 2.08