Lineage for d4yl2a_ (4yl2 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091860Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2091861Protein automated matches [190048] (21 species)
    not a true protein
  7. 2091862Species Aerococcus viridans [TaxId:1377] [187639] (8 PDB entries)
  8. 2091887Domain d4yl2a_: 4yl2 A: [276392]
    automated match to d2du2a_
    complexed with fmn, pyr; mutant

Details for d4yl2a_

PDB Entry: 4yl2 (more details), 1.9 Å

PDB Description: aerococcus viridans l-lactate oxidase y191f mutant
PDB Compounds: (A:) Lactate oxidase

SCOPe Domain Sequences for d4yl2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yl2a_ c.1.4.0 (A:) automated matches {Aerococcus viridans [TaxId: 1377]}
ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
aqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtimsisaysga
tfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdvkn
kfvfpfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfvkgiqhpe
dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
npygyey

SCOPe Domain Coordinates for d4yl2a_:

Click to download the PDB-style file with coordinates for d4yl2a_.
(The format of our PDB-style files is described here.)

Timeline for d4yl2a_: