SCOPe 2.08: Domain d4xake2: 4xak E:107-211

Lineage for d4xake2 (4xak E:107-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4xake2: 4xak E:107-211 [276390]
   Other proteins in same PDB: d4xake1, d4xakl1
   automated match to d1dn0a2
   complexed with gol, nag

Details for d4xake2

PDB Entry: 4xak, 2.45 Å

PDB Description: crystal structure of potent neutralizing antibody m336 in complex with mers co-v rbd

PDB Compounds: (E:) Light chain of neutralizing antibody m336

SCOPe Domain Sequences for d4xake2:

Sequence, based on SEQRES records:

>d4xake2 b.1.1.2 (E:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Sequence, based on observed residues (ATOM records):

>d4xake2 b.1.1.2 (E:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvqsgnsqesvteqdskd
styslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d4xake2:

• d4xake2 first appeared in SCOPe 2.05
  
• d4xake2 appears in SCOPe 2.07