SCOP 1.57: Domain d2madh_: 2mad H:

Lineage for d2madh_ (2mad H:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)

4. Superfamily b.69.2: Methylamine dehydrogenase, H-chain [50969] (1 family)

5. Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
   this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain

6. Protein Methylamine dehydrogenase, H-chain [50971] (2 species)

7. Species Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId:34007] [50973] (3 PDB entries)

8. Domain d2madh_: 2mad H: [27639]
   Other proteins in same PDB: d2madl_

Details for d2madh_

PDB Entry: 2mad, 2.25 Å

PDB Description: the active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor

SCOP Domain Sequences for d2madh_:

Sequence; same for both SEQRES and ATOM records:

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus)}
ssasaaaaaaaaalaagaadgptndeapgadgrrsyinlpahhsaiiqqwvldagsgsil
ghvnggflpnpvaahsgsefalastsfsriakgkrtdyvevfdpvtflpiadielpdapr
fdvgpyswmnantpnnadllffqfaagpavglvvqggssddqllssptcyhihpgapstf
yllcaqgglaktdhaggaagaglvgamltaaqnlltqpaqanksgrivwpvysgkilqad
isaagatnkapidalsggrkadtwrpggwqqvaylkssdgiylltseqsawklhaaakev
tsvtglvgqtssqislghdvdaisvaqdggpdlyalsagtevlhiydagagdqdqstvel
gsgpqvlsvmnea

Timeline for d2madh_:

• d2madh_ first appeared (with stable ids) in SCOP 1.55
  
• d2madh_ appears in SCOP 1.59
  
• d2madh_ appears in the current release, SCOPe 2.08