Lineage for d4xb3a2 (4xb3 A:464-536)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420422Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2420423Protein automated matches [226835] (41 species)
    not a true protein
  7. 2420644Species Streptococcus mutans [TaxId:210007] [276376] (2 PDB entries)
  8. 2420645Domain d4xb3a2: 4xb3 A:464-536 [276384]
    Other proteins in same PDB: d4xb3a1
    automated match to d2zida2
    complexed with ca, p6g

Details for d4xb3a2

PDB Entry: 4xb3 (more details), 2.09 Å

PDB Description: structure of dextran glucosidase
PDB Compounds: (A:) glucan 1,6-alpha-glucosidase

SCOPe Domain Sequences for d4xb3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xb3a2 b.71.1.0 (A:464-536) automated matches {Streptococcus mutans [TaxId: 210007]}
adfellptadkvfaylrkvreerylivvnvsdqeevleidvdkqetlisntnesaalanh
klqpwdafcikil

SCOPe Domain Coordinates for d4xb3a2:

Click to download the PDB-style file with coordinates for d4xb3a2.
(The format of our PDB-style files is described here.)

Timeline for d4xb3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xb3a1