SCOPe 2.07: Domain d3wyea_: 3wye A:

Lineage for d3wyea_ (3wye A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (58 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [276380] (2 PDB entries)

8. Domain d3wyea_: 3wye A: [276382]
   automated match to d1gege_
   complexed with nad

Details for d3wyea_

PDB Entry: 3wye, 1.58 Å

PDB Description: crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with nad+

PDB Compounds: (A:) Diacetyl reductase [(S)-acetoin forming],L-2,3-butanediol dehydrogenase,Diacetyl reductase [(S)-acetoin forming],L-2,3-butanediol dehydrogenase,Diacetyl reductase [(S)-acetoin forming],L-2,3-butanediol dehydrogenase,Diacetyl reductase [(S)-acetoin forming]

SCOPe Domain Sequences for d3wyea_:

Sequence; same for both SEQRES and ATOM records:

>d3wyea_ c.2.1.2 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kkvalvtgagqgigkaialrlvkdgfavaiadyndatakavaseinqagghavavkvdvs
drdqvfaaveqarktlggfdvivnnagiaqikpllevteedlkqiysvnvfsvffgiqaa
veafkkeghggkiinaasiaaiqgfpilsaysttkfavrgltqtaardlaplgitvngyc
pgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflaspdsdy
mtgqsllidggmvfn

Timeline for d3wyea_:

• d3wyea_ first appeared in SCOPe 2.05
  
• d3wyea_ appears in SCOPe 2.06
  
• d3wyea_ appears in the current release, SCOPe 2.08