Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein automated matches [190085] (58 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [276380] (2 PDB entries) |
Domain d3wyea_: 3wye A: [276382] automated match to d1gege_ complexed with nad |
PDB Entry: 3wye (more details), 1.58 Å
SCOPe Domain Sequences for d3wyea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wyea_ c.2.1.2 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]} kkvalvtgagqgigkaialrlvkdgfavaiadyndatakavaseinqagghavavkvdvs drdqvfaaveqarktlggfdvivnnagiaqikpllevteedlkqiysvnvfsvffgiqaa veafkkeghggkiinaasiaaiqgfpilsaysttkfavrgltqtaardlaplgitvngyc pgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflaspdsdy mtgqsllidggmvfn
Timeline for d3wyea_: