Lineage for d3wyeb_ (3wye B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (51 species)
    not a true protein
  7. 2092010Species Klebsiella pneumoniae [TaxId:573] [276380] (1 PDB entry)
  8. 2092012Domain d3wyeb_: 3wye B: [276381]
    automated match to d1gege_
    complexed with nad

Details for d3wyeb_

PDB Entry: 3wye (more details), 1.58 Å

PDB Description: crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with nad+
PDB Compounds: (B:) Diacetyl reductase [(S)-acetoin forming], L-2, 3-butanediol dehydrogenase

SCOPe Domain Sequences for d3wyeb_:

Sequence, based on SEQRES records: (download)

>d3wyeb_ c.2.1.2 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kvalvtgagqgigkaialrlvkdgfavaiadyndatakavaseinqagghavavkvdvsd
rdqvfaaveqarktlggfdvivnnagiaqikpllevteedlkqiysvnvfsvffgiqaav
eafkkeghggkiinaasiaaiqgfpilsaysttkfavrgltqtaardlaplgitvngycp
givgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflaspdsdym
tgqsllidggmvfn

Sequence, based on observed residues (ATOM records): (download)

>d3wyeb_ c.2.1.2 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kvalvtgagqgigkaialrlvkdgfavaiadyndatakavaseinqagghavavkvdvsd
rdqvfaaveqarktlggfdvivnnagiaqikpllevteedlkqiysvnvfsvffgiqaav
eafkkeghggkiinaasiaaiqgfpilsaysttkfavrgltqtaardlaplgitvngycp
givgtgmweqidaelsksialgrpsvpedvaglvsflaspdsdymtgqsllidggmvfn

SCOPe Domain Coordinates for d3wyeb_:

Click to download the PDB-style file with coordinates for d3wyeb_.
(The format of our PDB-style files is described here.)

Timeline for d3wyeb_: