Lineage for d1mdaj_ (1mda J:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17159Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)
  4. 17167Superfamily b.69.2: Methylamine dehydrogenase, H-chain [50969] (1 family) (S)
  5. 17168Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
  6. 17169Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 17174Species Paracoccus denitrificans [TaxId:266] [50972] (3 PDB entries)
  8. 17179Domain d1mdaj_: 1mda J: [27638]
    Other proteins in same PDB: d1mdaa_, d1mdab_, d1mdal_, d1mdam_

Details for d1mdaj_

PDB Entry: 1mda (more details), 2.5 Å

PDB Description: crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin
PDB Compounds: (J:)

SCOP Domain Sequences for d1mdaj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdaj_ b.69.2.1 (J:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans}
ekskvagsaaaasaaaasdgsscdhgpgaisrrshitlpayfagttenwvscagcgvtlg
hslgaflslavaghsgsdfalastsfarsakgkrtdyvevfdpvtflpiadielpdaprf
svgprvhiigncassacllfflfgssaaaglsvpgasddqltksascfhihpgaaathyl
gscpaslaasdlaaapaaagivgaqctgaqncssqaaqanypgmlvwavassilqgdipa
agatmkaaidgnesgrkadnfrsagfqmvaklkntdgimiltvehsrsclaaaentssvt
asvgqtsgpisnghdsdaiiaaqdgasdnyansagtevldiydaasdqdqssveldkgpe
slsvqnea

SCOP Domain Coordinates for d1mdaj_:

Click to download the PDB-style file with coordinates for d1mdaj_.
(The format of our PDB-style files is described here.)

Timeline for d1mdaj_: