SCOPe 2.06: Domain d4wzvb_: 4wzv B:

Lineage for d4wzvb_ (4wzv B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Gelatinase B (MMP-9) [75496] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75497] (16 PDB entries)

8. Domain d4wzvb_: 4wzv B: [276378]
   automated match to d4h3xa_
   complexed with azi, ca, e40, edo, gol, na, peg, pgo, zn

Details for d4wzvb_

PDB Entry: 4wzv, 1.65 Å

PDB Description: crystal structure of a hydroxamate based inhibitor en140 in complex with the mmp-9 catalytic domain

PDB Compounds: (B:) Matrix metalloproteinase-9,Matrix metalloproteinase-9

SCOPe Domain Sequences for d4wzvb_:

Sequence; same for both SEQRES and ATOM records:

>d4wzvb_ d.92.1.11 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
gdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfg
vaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaahefgha
lgldhssvpealmypmyrftegpplhkddvngirhlyg

Timeline for d4wzvb_:

• d4wzvb_ first appeared in SCOPe 2.05
  
• d4wzvb_ appears in SCOPe 2.07
  
• d4wzvb_ appears in the current release, SCOPe 2.08