SCOPe 2.05: Domain d4wlca2: 4wlc A:464-536

Lineage for d4wlca2 (4wlc A:464-536)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (30 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:210007] [276376] (2 PDB entries)

8. Domain d4wlca2: 4wlc A:464-536 [276377]
   Other proteins in same PDB: d4wlca1
   automated match to d2zida2
   complexed with bgc, ca, gol

Details for d4wlca2

PDB Entry: 4wlc, 2.4 Å

PDB Description: structure of dextran glucosidase with glucose

PDB Compounds: (A:) glucan 1,6-alpha-glucosidase

SCOPe Domain Sequences for d4wlca2:

Sequence; same for both SEQRES and ATOM records:

>d4wlca2 b.71.1.0 (A:464-536) automated matches {Streptococcus mutans [TaxId: 210007]}
adfellptadkvfaylrkvreerylivvnvsdqeevleidvdkqetlisntnesaalanh
klqpwdafcikil

Timeline for d4wlca2:

• d4wlca2 is new in SCOPe 2.05-stable
  
• d4wlca2 appears in SCOPe 2.06
  
• d4wlca2 appears in the current release, SCOPe 2.08