SCOPe 2.07: Domain d4wlca1: 4wlc A:1-463

Lineage for d4wlca1 (4wlc A:1-463)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (125 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:210007] [194595] (4 PDB entries)

8. Domain d4wlca1: 4wlc A:1-463 [276375]
   Other proteins in same PDB: d4wlca2
   automated match to d2zida1
   complexed with bgc, ca, gol

Details for d4wlca1

PDB Entry: 4wlc, 2.4 Å

PDB Description: structure of dextran glucosidase with glucose

PDB Compounds: (A:) glucan 1,6-alpha-glucosidase

SCOPe Domain Sequences for d4wlca1:

Sequence; same for both SEQRES and ATOM records:

>d4wlca1 c.1.8.0 (A:1-463) automated matches {Streptococcus mutans [TaxId: 210007]}
mqkhwwhkatvyqiypksfmdtngdgigdlkgitskldylqklgvmaiwlspvydspmdd
ngydianyeaiadifgnmadmdnlltqakmrgikiimdlvvnhtsdehawfiearehpds
serdyyiwcdqpndlesifggsawqyddksdqyylhffskkqpdlnwenanlrqkiydmm
nfwidkgiggfrmdvidmigkipaqhivsngpklhaylkemnaasfgqhdlltvgqtwga
tpeiakqysnpvnhelsmvfqfehiglqhkpeapkwdyvkelnvpalktifnkwqtelel
gqgwnslfwnnhdlprvlsiwgntgkyreksakalaillhlmrgtpyiyqgeeigmtnyp
fkdlnelddieslnyakeaftngksmetimdsirmigrdnartpmqwdasqnagfstadk
twlpvnpnykdinvqaalknsnsifytyqqliqlrkendwlvd

Timeline for d4wlca1:

• d4wlca1 first appeared in SCOPe 2.05
  
• d4wlca1 appears in SCOPe 2.06
  
• d4wlca1 appears in the current release, SCOPe 2.08