Lineage for d4wlca1 (4wlc A:1-463)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (93 species)
    not a true protein
  7. 2419462Species Streptococcus mutans [TaxId:210007] [194595] (4 PDB entries)
  8. 2419466Domain d4wlca1: 4wlc A:1-463 [276375]
    Other proteins in same PDB: d4wlca2
    automated match to d2zida1
    complexed with bgc, ca, gol

Details for d4wlca1

PDB Entry: 4wlc (more details), 2.4 Å

PDB Description: structure of dextran glucosidase with glucose
PDB Compounds: (A:) glucan 1,6-alpha-glucosidase

SCOPe Domain Sequences for d4wlca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wlca1 c.1.8.0 (A:1-463) automated matches {Streptococcus mutans [TaxId: 210007]}
mqkhwwhkatvyqiypksfmdtngdgigdlkgitskldylqklgvmaiwlspvydspmdd
ngydianyeaiadifgnmadmdnlltqakmrgikiimdlvvnhtsdehawfiearehpds
serdyyiwcdqpndlesifggsawqyddksdqyylhffskkqpdlnwenanlrqkiydmm
nfwidkgiggfrmdvidmigkipaqhivsngpklhaylkemnaasfgqhdlltvgqtwga
tpeiakqysnpvnhelsmvfqfehiglqhkpeapkwdyvkelnvpalktifnkwqtelel
gqgwnslfwnnhdlprvlsiwgntgkyreksakalaillhlmrgtpyiyqgeeigmtnyp
fkdlnelddieslnyakeaftngksmetimdsirmigrdnartpmqwdasqnagfstadk
twlpvnpnykdinvqaalknsnsifytyqqliqlrkendwlvd

SCOPe Domain Coordinates for d4wlca1:

Click to download the PDB-style file with coordinates for d4wlca1.
(The format of our PDB-style files is described here.)

Timeline for d4wlca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wlca2