Lineage for d4v0je_ (4v0j E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703609Species Castor bean (Ricinus communis) [TaxId:3988] [187330] (3 PDB entries)
  8. 2703620Domain d4v0je_: 4v0j E: [276374]
    automated match to d2uw1b_
    complexed with fe2, gol; mutant

Details for d4v0je_

PDB Entry: 4v0j (more details), 2.8 Å

PDB Description: the channel-block ser202glu, thr104lys double mutant of stearoyl-acp-desaturase from castor bean (ricinus communis)
PDB Compounds: (E:) acyl-[acyl-carrier-protein] desaturase, chloroplastic

SCOPe Domain Sequences for d4v0je_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v0je_ a.25.1.2 (E:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
pqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfdeqvrelrerakeipdd
yfvvlvgdmikeealptyqtmlntldgvrdetgasptswaiwtrawtaeenrhgdllnky
lylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqeratfiehgntarqakeh
gdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadmmrkkismpahlmydg
rddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsaegqkaqdyvcrlppr
irrleeraqgrakeaptmpfswifdrqvkl

SCOPe Domain Coordinates for d4v0je_:

Click to download the PDB-style file with coordinates for d4v0je_.
(The format of our PDB-style files is described here.)

Timeline for d4v0je_: