Lineage for d4v2pa2 (4v2p A:186-335)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918054Species Myxococcus fulvus [TaxId:33] [276368] (1 PDB entry)
  8. 2918056Domain d4v2pa2: 4v2p A:186-335 [276372]
    automated match to d3gwaa2
    complexed with cl, mpd, na, po4

Details for d4v2pa2

PDB Entry: 4v2p (more details), 1.67 Å

PDB Description: ketosynthase mxnb
PDB Compounds: (A:) ketosynthase

SCOPe Domain Sequences for d4v2pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v2pa2 c.95.1.0 (A:186-335) automated matches {Myxococcus fulvus [TaxId: 33]}
ihashlrtygfgaefsevrgggsrkppnskdtrpednylhmngaellkigfeylpkftes
lwkqcpditvrdvkyiiphqpsrvvldylslsypeekliriierfgncigasmpmalyea
vklrglqrgdkavltgtgsgvsfvgmvfty

SCOPe Domain Coordinates for d4v2pa2:

Click to download the PDB-style file with coordinates for d4v2pa2.
(The format of our PDB-style files is described here.)

Timeline for d4v2pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4v2pa1