Lineage for d1mdah_ (1mda H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065850Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2065851Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
    automatically mapped to Pfam PF06433
  6. 2065852Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 2065853Species Paracoccus denitrificans [TaxId:266] [50972] (5 PDB entries)
  8. 2065865Domain d1mdah_: 1mda H: [27637]
    Other proteins in same PDB: d1mdaa_, d1mdab_, d1mdal_, d1mdam_
    complexed with cu

Details for d1mdah_

PDB Entry: 1mda (more details), 2.5 Å

PDB Description: crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin
PDB Compounds: (H:) methylamine dehydrogenase (heavy subunit)

SCOPe Domain Sequences for d1mdah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}
ekskvagsaaaasaaaasdgsscdhgpgaisrrshitlpayfagttenwvscagcgvtlg
hslgaflslavaghsgsdfalastsfarsakgkrtdyvevfdpvtflpiadielpdaprf
svgprvhiigncassacllfflfgssaaaglsvpgasddqltksascfhihpgaaathyl
gscpaslaasdlaaapaaagivgaqctgaqncssqaaqanypgmlvwavassilqgdipa
agatmkaaidgnesgrkadnfrsagfqmvaklkntdgimiltvehsrsclaaaentssvt
asvgqtsgpisnghdsdaiiaaqdgasdnyansagtevldiydaasdqdqssveldkgpe
slsvqnea

SCOPe Domain Coordinates for d1mdah_:

Click to download the PDB-style file with coordinates for d1mdah_.
(The format of our PDB-style files is described here.)

Timeline for d1mdah_: