Lineage for d4v2pb1 (4v2p B:7-185)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525303Species Myxococcus fulvus [TaxId:33] [276368] (1 PDB entry)
  8. 2525306Domain d4v2pb1: 4v2p B:7-185 [276369]
    automated match to d3gwea1
    complexed with cl, mpd, na, po4

Details for d4v2pb1

PDB Entry: 4v2p (more details), 1.67 Å

PDB Description: ketosynthase mxnb
PDB Compounds: (B:) ketosynthase

SCOPe Domain Sequences for d4v2pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v2pb1 c.95.1.0 (B:7-185) automated matches {Myxococcus fulvus [TaxId: 33]}
fslpfklaglgryvpedivlsselekkydlpqgwclekqgirerrwvkgetaafmgaeaa
keavrdaglqlsdidliisasgspqqavpdggplvqrelglgrsgtpaitvnasclsffv
alevasnylnmrryrrilvvsadiasvsldfrkpenftlfgdaaaaavvtlpepgeksc

SCOPe Domain Coordinates for d4v2pb1:

Click to download the PDB-style file with coordinates for d4v2pb1.
(The format of our PDB-style files is described here.)

Timeline for d4v2pb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4v2pb2