![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein automated matches [190435] (12 species) not a true protein |
![]() | Species Castor bean (Ricinus communis) [TaxId:3988] [187330] (3 PDB entries) |
![]() | Domain d4v0jc_: 4v0j C: [276366] automated match to d2uw1b_ complexed with fe2, gol; mutant |
PDB Entry: 4v0j (more details), 2.8 Å
SCOPe Domain Sequences for d4v0jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v0jc_ a.25.1.2 (C:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]} qkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfdeqvrelrerakeipddy fvvlvgdmikeealptyqtmlntldgvrdetgasptswaiwtrawtaeenrhgdllnkyl ylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqeratfiehgntarqakehg diklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadmmrkkismpahlmydgr ddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsaegqkaqdyvcrlppri rrleeraqgrakeaptmpfswifdrqvkl
Timeline for d4v0jc_: