SCOPe 2.05: Domain d2mtah_: 2mta H:

Lineage for d2mtah_ (2mta H:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families)

5. Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
   less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
   automatically mapped to Pfam PF06433

6. Protein Methylamine dehydrogenase, H-chain [50971] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [50972] (5 PDB entries)

8. Domain d2mtah_: 2mta H: [27636]
   Other proteins in same PDB: d2mtaa_, d2mtac_, d2mtal_
   complexed with cu, hem, po4

Details for d2mtah_

PDB Entry: 2mta, 2.4 Å

PDB Description: crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome

PDB Compounds: (H:) methylamine dehydrogenase (heavy subunit)

SCOPe Domain Sequences for d2mtah_:

Sequence; same for both SEQRES and ATOM records:

>d2mtah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}
qgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagrvig
midggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpdaprf
lvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtff
mhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkihqid
lssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktasrfl
vvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsvnql
ghgpqvittadmg

Timeline for d2mtah_:

• d2mtah_ first appeared (with stable ids) in SCOP 1.55
  
• d2mtah_ appears in SCOPe 2.04
  
• d2mtah_ appears in SCOPe 2.06
  
• d2mtah_ appears in the current release, SCOPe 2.07