![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) ![]() |
![]() | Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein) less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit automatically mapped to Pfam PF06433 this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain |
![]() | Protein Methylamine dehydrogenase, H-chain [50971] (2 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [50972] (5 PDB entries) |
![]() | Domain d2mtah_: 2mta H: [27636] Other proteins in same PDB: d2mtaa_, d2mtac_, d2mtal_ complexed with cu, hem, po4 |
PDB Entry: 2mta (more details), 2.4 Å
SCOPe Domain Sequences for d2mtah_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mtah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} qgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagrvig midggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpdaprf lvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtff mhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkihqid lssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktasrfl vvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsvnql ghgpqvittadmg
Timeline for d2mtah_: