Lineage for d2mtah_ (2mta H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803012Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1803039Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 1803040Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
    automatically mapped to Pfam PF06433

    this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain
  6. 1803041Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 1803042Species Paracoccus denitrificans [TaxId:266] [50972] (5 PDB entries)
  8. 1803049Domain d2mtah_: 2mta H: [27636]
    Other proteins in same PDB: d2mtaa_, d2mtac_, d2mtal_
    complexed with cu, hem, po4

Details for d2mtah_

PDB Entry: 2mta (more details), 2.4 Å

PDB Description: crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
PDB Compounds: (H:) methylamine dehydrogenase (heavy subunit)

SCOPe Domain Sequences for d2mtah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mtah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}
qgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagrvig
midggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpdaprf
lvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtff
mhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkihqid
lssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktasrfl
vvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsvnql
ghgpqvittadmg

SCOPe Domain Coordinates for d2mtah_:

Click to download the PDB-style file with coordinates for d2mtah_.
(The format of our PDB-style files is described here.)

Timeline for d2mtah_: