Lineage for d2mtah_ (2mta H:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170720Fold b.69: 7-bladed beta-propeller [50964] (10 superfamilies)
  4. 170730Superfamily b.69.2: Quinoprotein amine dehydrogenase catalytic subunit [50969] (2 families) (S)
  5. 170731Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain
  6. 170732Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 170737Species Paracoccus denitrificans [TaxId:266] [50972] (3 PDB entries)
  8. 170740Domain d2mtah_: 2mta H: [27636]
    Other proteins in same PDB: d2mtaa_, d2mtac_, d2mtal_

Details for d2mtah_

PDB Entry: 2mta (more details), 2.4 Å

PDB Description: crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome

SCOP Domain Sequences for d2mtah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mtah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans}
qgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagrvig
midggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpdaprf
lvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtff
mhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkihqid
lssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktasrfl
vvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsvnql
ghgpqvittadmg

SCOP Domain Coordinates for d2mtah_:

Click to download the PDB-style file with coordinates for d2mtah_.
(The format of our PDB-style files is described here.)

Timeline for d2mtah_: