Lineage for d4tr9a_ (4tr9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836549Species Plasmodium falciparum [TaxId:36329] [276356] (1 PDB entry)
  8. 2836550Domain d4tr9a_: 4tr9 A: [276357]
    automated match to d3kx6a_
    complexed with 38d

Details for d4tr9a_

PDB Entry: 4tr9 (more details), 2.11 Å

PDB Description: ternary co-crystal structure of fructose-bisphosphate aldolase from plasmodium falciparum in complex with trap and a small molecule inhibitor
PDB Compounds: (A:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d4tr9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tr9a_ c.1.10.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
eymnapkklpadvaeelattaqklvqagkgilaadestqtikkrfdniklentienrasy
rdllfgtkglgkfisgailfeetlfqkneagvpmvnllhneniipgikvdkglvnipctd
eekstqgldglaerckeyykagarfakwrtvlvidtakgkptdlsihetawglaryasic
qqnrlvpivepeiladgphsievcavvtqkvlscvfkalqengvllegallkpnmvtagy
ectaktttqdvgfltvrtlrrtvppalpgvvflsggqseeeasvnlnsinalgphpwalt
fsygralqasvlntwqgkkenvakarevllqraeanslatygkykgg

SCOPe Domain Coordinates for d4tr9a_:

Click to download the PDB-style file with coordinates for d4tr9a_.
(The format of our PDB-style files is described here.)

Timeline for d4tr9a_: