![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (26 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries) |
![]() | Domain d4r8wl_: 4r8w L: [276355] Other proteins in same PDB: d4r8wa_, d4r8wb_ automated match to d1kxtb_ complexed with nag |
PDB Entry: 4r8w (more details), 2.79 Å
SCOPe Domain Sequences for d4r8wl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r8wl_ b.1.1.0 (L:) automated matches {Homo sapiens [TaxId: 9606]} evvltqspgtlalppgeratlscrashrvgstyiawyqqksgqaprrliygasnratdip drfsgsgsgtdftltirrlepedsavyycqqfsvspwtfgqgtrveikrt
Timeline for d4r8wl_: