Lineage for d4rl4a_ (4rl4 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1886499Fold c.144: RibA-like [142694] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 1235467, strands 1 and 3 are antiparallel to the rest; partial topological similarity to some alpha/beta hydrolases (53473)
  4. 1886500Superfamily c.144.1: RibA-like [142695] (2 families) (S)
    automatically mapped to Pfam PF00925
  5. 1886507Family c.144.1.0: automated matches [276350] (1 protein)
    not a true family
  6. 1886508Protein automated matches [276351] (1 species)
    not a true protein
  7. 1886509Species Helicobacter pylori [TaxId:85962] [276352] (1 PDB entry)
  8. 1886510Domain d4rl4a_: 4rl4 A: [276353]
    automated match to d2bz1a_
    complexed with ppv

Details for d4rl4a_

PDB Entry: 4rl4 (more details), 2.2 Å

PDB Description: crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695
PDB Compounds: (A:) GTP cyclohydrolase-2

SCOPe Domain Sequences for d4rl4a_:

Sequence, based on SEQRES records: (download)

>d4rl4a_ c.144.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
qghmkrlevsnqaklptqfgefyiqcfrekgsngskdhlvvftpnfsqnplvrlhseclt
gdalgsqkcdcggalqmaleriskegglviylrqegrgiglfnkvnayalqdkgydtiqa
nemigfkdderdysvageileyyrikkmrlltnnpkkiaalekyaevtreslivca

Sequence, based on observed residues (ATOM records): (download)

>d4rl4a_ c.144.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
qghmkrlevsnqaklptqfgefyiqcfrekgskdhlvvftpnfsqnplvrlhsecltgda
lgsqkcdcggalqmaleriskegglviylrqegrgiglfnkvnayalqdkgydtiqanem
igfkdderdysvageileyyrikkmrlltnnpkkiaalekyaevtreslivca

SCOPe Domain Coordinates for d4rl4a_:

Click to download the PDB-style file with coordinates for d4rl4a_.
(The format of our PDB-style files is described here.)

Timeline for d4rl4a_: