Lineage for d4rl4a1 (4rl4 A:1-173)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923604Fold c.144: RibA-like [142694] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 1235467, strands 1 and 3 are antiparallel to the rest; partial topological similarity to some alpha/beta hydrolases (53473)
  4. 2923605Superfamily c.144.1: RibA-like [142695] (2 families) (S)
    automatically mapped to Pfam PF00925
  5. 2923612Family c.144.1.0: automated matches [276350] (1 protein)
    not a true family
  6. 2923613Protein automated matches [276351] (1 species)
    not a true protein
  7. 2923614Species Helicobacter pylori [TaxId:85962] [276352] (1 PDB entry)
  8. 2923615Domain d4rl4a1: 4rl4 A:1-173 [276353]
    Other proteins in same PDB: d4rl4a2, d4rl4b2
    automated match to d2bz1a_
    complexed with ppv

Details for d4rl4a1

PDB Entry: 4rl4 (more details), 2.2 Å

PDB Description: crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695
PDB Compounds: (A:) GTP cyclohydrolase-2

SCOPe Domain Sequences for d4rl4a1:

Sequence, based on SEQRES records: (download)

>d4rl4a1 c.144.1.0 (A:1-173) automated matches {Helicobacter pylori [TaxId: 85962]}
mkrlevsnqaklptqfgefyiqcfrekgsngskdhlvvftpnfsqnplvrlhsecltgda
lgsqkcdcggalqmaleriskegglviylrqegrgiglfnkvnayalqdkgydtiqanem
igfkdderdysvageileyyrikkmrlltnnpkkiaalekyaevtreslivca

Sequence, based on observed residues (ATOM records): (download)

>d4rl4a1 c.144.1.0 (A:1-173) automated matches {Helicobacter pylori [TaxId: 85962]}
mkrlevsnqaklptqfgefyiqcfrekgskdhlvvftpnfsqnplvrlhsecltgdalgs
qkcdcggalqmaleriskegglviylrqegrgiglfnkvnayalqdkgydtiqanemigf
kdderdysvageileyyrikkmrlltnnpkkiaalekyaevtreslivca

SCOPe Domain Coordinates for d4rl4a1:

Click to download the PDB-style file with coordinates for d4rl4a1.
(The format of our PDB-style files is described here.)

Timeline for d4rl4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rl4a2