SCOPe 2.05: Domain d4r8wb_: 4r8w B:

Lineage for d4r8wb_ (4r8w B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/anhui/1-balf_rg45/2013(h7n9)) [TaxId:1481988] [276346] (1 PDB entry)

8. Domain d4r8wb_: 4r8w B: [276347]
   Other proteins in same PDB: d4r8wa_, d4r8wl_
   automated match to d4d00d_
   complexed with nag

Details for d4r8wb_

PDB Entry: 4r8w, 2.79 Å

PDB Description: crystal structure of h7 hemagglutinin from a/anhui/1/2013 in complex with a neutralizing antibody ct149

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4r8wb_:

Sequence; same for both SEQRES and ATOM records:

>d4r8wb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/anhui/1-balf_rg45/2013(h7n9)) [TaxId: 1481988]}
lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
qfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

Timeline for d4r8wb_:

• d4r8wb_ is new in SCOPe 2.05-stable
  
• d4r8wb_ appears in SCOPe 2.06
  
• d4r8wb_ appears in the current release, SCOPe 2.08