Lineage for d4r8wb_ (4r8w B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040828Species Influenza A virus (a/anhui/1-balf_rg45/2013(h7n9)) [TaxId:1481988] [311113] (1 PDB entry)
  8. 3040829Domain d4r8wb_: 4r8w B: [276347]
    Other proteins in same PDB: d4r8wa_, d4r8wh_, d4r8wl_
    automated match to d4d00d_
    complexed with nag

Details for d4r8wb_

PDB Entry: 4r8w (more details), 2.8 Å

PDB Description: crystal structure of h7 hemagglutinin from a/anhui/1/2013 in complex with a neutralizing antibody ct149
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4r8wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r8wb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (a/anhui/1-balf_rg45/2013(h7n9)) [TaxId: 1481988]}
lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
qfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

SCOPe Domain Coordinates for d4r8wb_:

Click to download the PDB-style file with coordinates for d4r8wb_.
(The format of our PDB-style files is described here.)

Timeline for d4r8wb_: