Lineage for d4rafa2 (4raf A:297-368)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735563Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 2735564Superfamily a.159.1: Protein serine/threonine phosphatase 2C, C-terminal domain [81601] (2 families) (S)
    automatically mapped to Pfam PF07830
  5. 2735569Family a.159.1.0: automated matches [232204] (1 protein)
    not a true family
  6. 2735570Protein automated matches [232205] (1 species)
    not a true protein
  7. 2735571Species Human (Homo sapiens) [TaxId:9606] [232206] (8 PDB entries)
  8. 2735579Domain d4rafa2: 4raf A:297-368 [276345]
    Other proteins in same PDB: d4rafa1
    automated match to d1a6qa1
    complexed with mn

Details for d4rafa2

PDB Entry: 4raf (more details), 2 Å

PDB Description: crystal structure of pp2ca-d38a
PDB Compounds: (A:) Protein phosphatase 1A

SCOPe Domain Sequences for d4rafa2:

Sequence, based on SEQRES records: (download)

>d4rafa2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrn
vieavynrlnpy

Sequence, based on observed residues (ATOM records): (download)

>d4rafa2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikvpdlvhvmrtlasenipslppggelaskrnvieav
ynrlnpy

SCOPe Domain Coordinates for d4rafa2:

Click to download the PDB-style file with coordinates for d4rafa2.
(The format of our PDB-style files is described here.)

Timeline for d4rafa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rafa1