SCOPe 2.08: Domain d4raga2: 4rag A:297-368

Lineage for d4raga2 (4rag A:297-368)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
   topologically similar to the DNA/RNA-binding bundles; distinct packing

4. Superfamily a.159.1: Protein serine/threonine phosphatase 2C, C-terminal domain [81601] (2 families)
   automatically mapped to Pfam PF07830

5. Family a.159.1.0: automated matches [232204] (1 protein)
   not a true family

6. Protein automated matches [232205] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232206] (8 PDB entries)

8. Domain d4raga2: 4rag A:297-368 [276344]
   Other proteins in same PDB: d4raga1
   automated match to d1a6qa1
   complexed with mn

Details for d4raga2

PDB Entry: 4rag, 1.85 Å

PDB Description: crystal structure of ppc2a-d38k

PDB Compounds: (A:) Protein phosphatase 1A

SCOPe Domain Sequences for d4raga2:

Sequence, based on SEQRES records:

>d4raga2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrn
vieavynrlnpy

Sequence, based on observed residues (ATOM records):

>d4raga2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikvpdlvhvmrtlasenipslppggelaskrnvieav
ynrlnpy

Timeline for d4raga2:

• d4raga2 first appeared in SCOPe 2.05
  
• d4raga2 appears in SCOPe 2.07