Lineage for d4r5zc1 (4r5z C:2-353)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2149079Species Mycobacterium tuberculosis [TaxId:83332] [187938] (7 PDB entries)
  8. 2149086Domain d4r5zc1: 4r5z C:2-353 [276338]
    Other proteins in same PDB: d4r5za2, d4r5zb2, d4r5zc2, d4r5zd2
    automated match to d3ffha_
    complexed with epe, gol, pmp, sin

Details for d4r5zc1

PDB Entry: 4r5z (more details), 1.95 Å

PDB Description: crystal structure of rv3772 encoded aminotransferase
PDB Compounds: (C:) Putative phenylalanine aminotransferase

SCOPe Domain Sequences for d4r5zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r5zc1 c.67.1.0 (C:2-353) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tarlrpelaglpvyvpgktvpgaiklasnetvfgplpsvraaidratdtvnrypdngcvq
lkaalarhlgpdfapehvavgcgsvslcqqlvqvtasvgdevvfgwrsfelyppqvrvag
aipiqvpltdhtfdlyamlatvtdrtrlifvcnpnnptstvvgpdalarfveavpahili
aideayveyirdgmrpdslglvrahnnvvvlrtfskayglaglrigyaighpdvitaldk
vyvpftvssigqaaaiasldaadellartdtvvaerarvsaelraagftlppsqanfvwl
plgsrtqdfveqaadarivvrpygtdgvrvtvaapeendaflrfarrwrsdq

SCOPe Domain Coordinates for d4r5zc1:

Click to download the PDB-style file with coordinates for d4r5zc1.
(The format of our PDB-style files is described here.)

Timeline for d4r5zc1: