Lineage for d4pvza_ (4pvz A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006432Protein Karyopherin alpha [48383] (2 species)
  7. 2006444Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [276329] (1 PDB entry)
  8. 2006445Domain d4pvza_: 4pvz A: [276331]
    automated match to d1ee4a_

Details for d4pvza_

PDB Entry: 4pvz (more details), 2.5 Å

PDB Description: structure of yeast importin a bound to the membrane protein nuclear localization signal sequence of inm protein heh2
PDB Compounds: (A:) importin subunit alpha

SCOPe Domain Sequences for d4pvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pvza_ a.118.1.1 (A:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
lvkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
yf

SCOPe Domain Coordinates for d4pvza_:

Click to download the PDB-style file with coordinates for d4pvza_.
(The format of our PDB-style files is described here.)

Timeline for d4pvza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4pvzb_