Lineage for d1goha3 (1goh A:151-537)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065824Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) (S)
  5. 2065825Family b.69.1.1: Galactose oxidase, central domain [50966] (2 protein domains)
  6. 2065826Protein Galactose oxidase, central domain [50967] (3 species)
    N-terminal domain is a jelly-roll sandwich
    C-terminal domain is Immunoglobulin-like
  7. 2065827Species Dactylium dendroides [TaxId:5132] [50968] (4 PDB entries)
    Uniprot Q01745 42-680
  8. 2065830Domain d1goha3: 1goh A:151-537 [27633]
    Other proteins in same PDB: d1goha1, d1goha2
    complexed with na

Details for d1goha3

PDB Entry: 1goh (more details), 2.2 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1goha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goha3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Dactylium dendroides [TaxId: 5132]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

SCOPe Domain Coordinates for d1goha3:

Click to download the PDB-style file with coordinates for d1goha3.
(The format of our PDB-style files is described here.)

Timeline for d1goha3: