Lineage for d1goga3 (1gog A:151-537)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418202Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) (S)
  5. 2418203Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)
  6. 2418204Protein Galactose oxidase, central domain [50967] (3 species)
    N-terminal domain is a jelly-roll sandwich
    C-terminal domain is Immunoglobulin-like
  7. 2418205Species Dactylium dendroides [TaxId:5132] [50968] (4 PDB entries)
    Uniprot Q01745 42-680
  8. 2418208Domain d1goga3: 1gog A:151-537 [27632]
    Other proteins in same PDB: d1goga1, d1goga2
    complexed with cu, na

Details for d1goga3

PDB Entry: 1gog (more details), 1.9 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1goga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goga3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Dactylium dendroides [TaxId: 5132]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

SCOPe Domain Coordinates for d1goga3:

Click to download the PDB-style file with coordinates for d1goga3.
(The format of our PDB-style files is described here.)

Timeline for d1goga3: