![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) ![]() |
![]() | Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins) |
![]() | Protein Galactose oxidase, central domain [50967] (3 species) N-terminal domain is a jelly-roll sandwich C-terminal domain is Immunoglobulin-like |
![]() | Species Dactylium dendroides [TaxId:5132] [50968] (4 PDB entries) Uniprot Q01745 42-680 |
![]() | Domain d1goga3: 1gog A:151-537 [27632] Other proteins in same PDB: d1goga1, d1goga2 complexed with cu, na |
PDB Entry: 1gog (more details), 1.9 Å
SCOPe Domain Sequences for d1goga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goga3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Dactylium dendroides [TaxId: 5132]} ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng ggglcgdcttnhfdaqiftpnylynsn
Timeline for d1goga3: