Class b: All beta proteins [48724] (174 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family) |
Family b.69.1.1: Galactose oxidase, central domain [50966] (1 protein) |
Protein Galactose oxidase, central domain [50967] (3 species) N-terminal domain is a jelly-roll sandwich C-terminal domain is Immunoglobulin-like |
Species Dactylium dendroides [TaxId:5132] [50968] (4 PDB entries) Uniprot Q01745 42-680 |
Domain d1gofa3: 1gof A:151-537 [27631] Other proteins in same PDB: d1gofa1, d1gofa2 complexed with acy, cu, na |
PDB Entry: 1gof (more details), 1.7 Å
SCOPe Domain Sequences for d1gofa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gofa3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Dactylium dendroides [TaxId: 5132]} ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng ggglcgdcttnhfdaqiftpnylynsn
Timeline for d1gofa3: