SCOPe 2.01: Domain d1gofa3: 1gof A:151-537

Lineage for d1gofa3 (1gof A:151-537)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family)

5. Family b.69.1.1: Galactose oxidase, central domain [50966] (1 protein)

6. Protein Galactose oxidase, central domain [50967] (3 species)
   N-terminal domain is a jelly-roll sandwich
   C-terminal domain is Immunoglobulin-like

7. Species Dactylium dendroides [TaxId:5132] [50968] (8 PDB entries)
   Uniprot Q01745 42-680

8. Domain d1gofa3: 1gof A:151-537 [27631]
   Other proteins in same PDB: d1gofa1, d1gofa2
   complexed with acy, cu, na

Details for d1gofa3

PDB Entry: 1gof, 1.7 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1gofa3:

Sequence; same for both SEQRES and ATOM records:

>d1gofa3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Dactylium dendroides [TaxId: 5132]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

Timeline for d1gofa3:

• d1gofa3 first appeared (with stable ids) in SCOP 1.55, called d1gof_3
  
• d1gofa3 appears in SCOP 1.75
  
• d1gofa3 appears in SCOPe 2.02
  
• d1gofa3 appears in the current release, SCOPe 2.08