Lineage for d5ctod1 (5cto D:30-193)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549945Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2549946Protein automated matches [190239] (26 species)
    not a true protein
  7. 2550131Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [276308] (1 PDB entry)
  8. 2550135Domain d5ctod1: 5cto D:30-193 [276309]
    Other proteins in same PDB: d5ctoa2, d5ctob2, d5ctoc2, d5ctod2
    automated match to d1sp9b1
    complexed with fe, ntd

Details for d5ctod1

PDB Entry: 5cto (more details), 2.62 Å

PDB Description: crystal structure of arabidopsis thaliana hppd complexed with ntbc
PDB Compounds: (D:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5ctod1:

Sequence, based on SEQRES records: (download)

>d5ctod1 d.32.1.0 (D:30-193) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
ltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaieveda
esafsisvangaipssppivlneavtiaevklygdvvlryvsyk

Sequence, based on observed residues (ATOM records): (download)

>d5ctod1 d.32.1.0 (D:30-193) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
ltsgdlrflftapyspsltttasipsfdhgscrsffsshglgvravaievedaesafsis
vangaipssppivlneavtiaevklygdvvlryvsyk

SCOPe Domain Coordinates for d5ctod1:

Click to download the PDB-style file with coordinates for d5ctod1.
(The format of our PDB-style files is described here.)

Timeline for d5ctod1: