Lineage for d1c5ka1 (1c5k A:163-431)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62715Fold b.68: 6-bladed beta-propeller [50938] (6 superfamilies)
  4. 62837Superfamily b.68.4: TolB, C-terminal domain [50960] (1 family) (S)
  5. 62838Family b.68.4.1: TolB, C-terminal domain [50961] (1 protein)
  6. 62839Protein TolB, C-terminal domain [50962] (1 species)
  7. 62840Species Escherichia coli [TaxId:562] [50963] (2 PDB entries)
  8. 62842Domain d1c5ka1: 1c5k A:163-431 [27630]
    Other proteins in same PDB: d1c5ka2

Details for d1c5ka1

PDB Entry: 1c5k (more details), 2 Å

PDB Description: the structure of tolb, an essential component of the tol-dependent translocation system and its interactions with the translocation domain of colicin e9

SCOP Domain Sequences for d1c5ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5ka1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

SCOP Domain Coordinates for d1c5ka1:

Click to download the PDB-style file with coordinates for d1c5ka1.
(The format of our PDB-style files is described here.)

Timeline for d1c5ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c5ka2