Lineage for d1crza1 (1crz A:141-409)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. Superfamily b.68.4: TolB, C-terminal domain [50960] (2 families) (S)
  5. Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins)
  6. Protein TolB, C-terminal domain [50962] (1 species)
  7. Species Escherichia coli [TaxId:562] [50963] (4 PDB entries)
  8. Domain d1crza1: 1crz A:141-409 [27629]
    Other proteins in same PDB: d1crza2

Details for d1crza1

PDB Entry: 1crz (more details), 1.95 Å

PDB Description: crystal structure of the e. coli tolb protein
PDB Compounds: (A:) tolb protein

SCOPe Domain Sequences for d1crza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crza1 b.68.4.1 (A:141-409) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

SCOPe Domain Coordinates for d1crza1 are not available.

Timeline for d1crza1:

Domains from same chain:
(mouse over for more information)
d1crza2