SCOPe 2.05: Domain d5cb6d_: 5cb6 D:

Lineage for d5cb6d_ (5cb6 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [276277] (2 PDB entries)

8. Domain d5cb6d_: 5cb6 D: [276286]
   automated match to d4bzpa_
   complexed with adx, anp, cac, mg, na

Details for d5cb6d_

PDB Entry: 5cb6, 2.79 Å

PDB Description: structure of adenosine-5'-phosphosulfate kinase

PDB Compounds: (D:) Probable adenylyl-sulfate kinase

SCOPe Domain Sequences for d5cb6d_:

Sequence; same for both SEQRES and ATOM records:

>d5cb6d_ c.37.1.0 (D:) automated matches {Synechocystis sp. [TaxId: 1111708]}
rgvtiwltglsgagkttithalekklrdsgyrlevldgdvvrtnltkglgfskedrdtni
rrigfvshlltrngvivlvsaispyaairqevkhtigdflevfvnaplavceerdvkgly
akarsgeikgftgiddpyepptnpdvecrtdleeldesvgkiwqklvdlkyie

Timeline for d5cb6d_:

• d5cb6d_ is new in SCOPe 2.05-stable
  
• d5cb6d_ appears in SCOPe 2.06
  
• d5cb6d_ appears in the current release, SCOPe 2.08