Lineage for d5cb6d_ (5cb6 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872967Species Synechocystis sp. [TaxId:1111708] [276277] (3 PDB entries)
  8. 2872973Domain d5cb6d_: 5cb6 D: [276286]
    automated match to d4bzpa_
    complexed with adx, anp, cac, mg, na

Details for d5cb6d_

PDB Entry: 5cb6 (more details), 2.79 Å

PDB Description: structure of adenosine-5'-phosphosulfate kinase
PDB Compounds: (D:) Probable adenylyl-sulfate kinase

SCOPe Domain Sequences for d5cb6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cb6d_ c.37.1.0 (D:) automated matches {Synechocystis sp. [TaxId: 1111708]}
rgvtiwltglsgagkttithalekklrdsgyrlevldgdvvrtnltkglgfskedrdtni
rrigfvshlltrngvivlvsaispyaairqevkhtigdflevfvnaplavceerdvkgly
akarsgeikgftgiddpyepptnpdvecrtdleeldesvgkiwqklvdlkyie

SCOPe Domain Coordinates for d5cb6d_:

Click to download the PDB-style file with coordinates for d5cb6d_.
(The format of our PDB-style files is described here.)

Timeline for d5cb6d_: