Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [276277] (3 PDB entries) |
Domain d5cb6a_: 5cb6 A: [276283] automated match to d4bzpa_ complexed with adx, anp, cac, mg, na |
PDB Entry: 5cb6 (more details), 2.79 Å
SCOPe Domain Sequences for d5cb6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cb6a_ c.37.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]} rgvtiwltglsgagkttithalekklrdsgyrlevldgdvvrtnltkglgfskedrdtni rrigfvshlltrngvivlvsaispyaairqevkhtigdflevfvnaplavceerdvkgly akarsgeikgftgiddpyepptnpdvecrtdleeldesvgkiwqklvdlkyie
Timeline for d5cb6a_: