Lineage for d1cvma_ (1cvm A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2075372Superfamily b.68.3: Thermostable phytase (3-phytase) [50956] (1 family) (S)
    automatically mapped to Pfam PF02333
  5. 2075373Family b.68.3.1: Thermostable phytase (3-phytase) [50957] (2 proteins)
  6. 2075374Protein Thermostable phytase (3-phytase) [50958] (1 species)
  7. 2075375Species Bacillus amyloliquefaciens [TaxId:1390] [50959] (5 PDB entries)
  8. 2075380Domain d1cvma_: 1cvm A: [27628]
    complexed with ca, cd

Details for d1cvma_

PDB Entry: 1cvm (more details), 2.4 Å

PDB Description: cadmium inhibited crystal structure of phytase from bacillus amyloliquefaciens
PDB Compounds: (A:) phytase

SCOPe Domain Sequences for d1cvma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvma_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}
klsdpyhftvnaaaetepvdtagdaaddpaiwldpknpqnsklittnkksglavyslegk
mlhsyhtgklnnvdirydfplngkkvdiaaasnrsegkntieiyaidgkngtlqsitdpn
rpiasaidevygfslyhsqktgkyyamvtgkegefeqyelnadkngyisgkkvrafkmns
qtegmaaddeygslyiaeedeaiwkfsaepdggsngtvidradgrhltpdiegltiyyaa
dgkgyllassqgnssyaiyerqgqnkyvadfqitdgpetdgtsdtdgidvlgfglgpeyp
fglfvaqngenidhgqkanqnfkmvpweriadkigfhpqvnkqvdprkmtdrs

SCOPe Domain Coordinates for d1cvma_:

Click to download the PDB-style file with coordinates for d1cvma_.
(The format of our PDB-style files is described here.)

Timeline for d1cvma_: