SCOPe 2.05: Domain d5c9ac_: 5c9a C:

Lineage for d5c9ac_ (5c9a C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (11 species)
   not a true protein

7. Species Coxsackievirus a16 [TaxId:31704] [276274] (3 PDB entries)

8. Domain d5c9ac_: 5c9a C: [276278]
   Other proteins in same PDB: d5c9aa_
   automated match to d3vbhc_
   complexed with cl, k, sph

Details for d5c9ac_

PDB Entry: 5c9a, 2.7 Å

PDB Description: crystal structure of empty coxsackievirus a16 particle

PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d5c9ac_:

Sequence; same for both SEQRES and ATOM records:

>d5c9ac_ b.121.4.1 (C:) automated matches {Coxsackievirus a16 [TaxId: 31704]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah
aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedieqtan
iq

Timeline for d5c9ac_:

• d5c9ac_ is new in SCOPe 2.05-stable
  
• d5c9ac_ appears in SCOPe 2.06
  
• d5c9ac_ appears in the current release, SCOPe 2.08