SCOPe 2.06: Domain d5c4wb_: 5c4w B:

Lineage for d5c4wb_ (5c4w B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (13 species)
   not a true protein

7. Species Coxsackievirus a16 [TaxId:31704] [276271] (3 PDB entries)

8. Domain d5c4wb_: 5c4w B: [276272]
   Other proteins in same PDB: d5c4wc_
   automated match to d4jgyb_
   complexed with cl, k, na, sph

Details for d5c4wb_

PDB Entry: 5c4w, 2.65 Å

PDB Description: crystal structure of coxsackievirus a16

PDB Compounds: (B:) vp2

SCOPe Domain Sequences for d5c4wb_:

Sequence; same for both SEQRES and ATOM records:

>d5c4wb_ b.121.4.0 (B:) automated matches {Coxsackievirus a16 [TaxId: 31704]}
sdrvaqltignstittqeaaniviaygewpeycpdtdatavdkptrpdvsvnrfftldtk
swakdskgwywkfpdvltevgvfgqnaqfhylyrsgfcvhvqcnaskfhqgallvavlpe
yvlgtiaggtgnenshppyattqpgqvgavlthpyvldagiplsqltvcphqwinlrtnn
catiivpymntvpfdsalnhcnfgllvipvvpldfntgatseipitvtiapmcaefaglr
qavkq

Timeline for d5c4wb_:

• d5c4wb_ first appeared in SCOPe 2.05
  
• d5c4wb_ appears in SCOPe 2.07
  
• d5c4wb_ appears in the current release, SCOPe 2.08