Lineage for d5c3ld1 (5c3l D:6-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742101Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2742185Domain d5c3ld1: 5c3l D:6-112 [276270]
    Other proteins in same PDB: d5c3ld2
    automated match to d4kfzc_

Details for d5c3ld1

PDB Entry: 5c3l (more details), 2.9 Å

PDB Description: structure of the metazoan nup62.nup58.nup54 nucleoporin complex.
PDB Compounds: (D:) Nanobody Nb15

SCOPe Domain Sequences for d5c3ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c3ld1 b.1.1.1 (D:6-112) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
esggglvqpggslrlscaasgftfsnyamswvrqapgkglevvsdigsggdrityadsvk
grftisrdnakntlylqmnslkpedtavyycanqygrgpgtqvtvss

SCOPe Domain Coordinates for d5c3ld1:

Click to download the PDB-style file with coordinates for d5c3ld1.
(The format of our PDB-style files is described here.)

Timeline for d5c3ld1: