SCOPe 2.08: Domain d5c3ld1: 5c3l D:6-112

Lineage for d5c3ld1 (5c3l D:6-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d5c3ld1: 5c3l D:6-112 [276270]
   Other proteins in same PDB: d5c3ld2
   automated match to d4kfzc_

Details for d5c3ld1

PDB Entry: 5c3l, 2.9 Å

PDB Description: structure of the metazoan nup62.nup58.nup54 nucleoporin complex.

PDB Compounds: (D:) Nanobody Nb15

SCOPe Domain Sequences for d5c3ld1:

Sequence; same for both SEQRES and ATOM records:

>d5c3ld1 b.1.1.1 (D:6-112) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
esggglvqpggslrlscaasgftfsnyamswvrqapgkglevvsdigsggdrityadsvk
grftisrdnakntlylqmnslkpedtavyycanqygrgpgtqvtvss

Timeline for d5c3ld1:

• d5c3ld1 first appeared in SCOPe 2.05, called d5c3ld_
  
• d5c3ld1 appears in SCOPe 2.07