Lineage for d5c2ub_ (5c2u B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754040Species Camel (Camelus dromedarius) [TaxId:9838] [276268] (8 PDB entries)
  8. 2754049Domain d5c2ub_: 5c2u B: [276269]
    automated match to d2ybrh_

Details for d5c2ub_

PDB Entry: 5c2u (more details), 1.55 Å

PDB Description: ferredoxin-like domain of nucleoporin nup54 bound to a nanobody
PDB Compounds: (B:) Nanobody

SCOPe Domain Sequences for d5c2ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c2ub_ b.1.1.0 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlqesggglvqpggslrlscvvsgdyyaigwfrqapgkeregvaaissrdgstyypdav
kgrftisrdnakntvylqmnslkpedtavyycaadrrqrwgpyyylsaleyvywgqgtqv
tvss

SCOPe Domain Coordinates for d5c2ub_:

Click to download the PDB-style file with coordinates for d5c2ub_.
(The format of our PDB-style files is described here.)

Timeline for d5c2ub_: