![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Camel (Camelus dromedarius) [TaxId:9838] [276268] (8 PDB entries) |
![]() | Domain d5c2ub_: 5c2u B: [276269] automated match to d2ybrh_ |
PDB Entry: 5c2u (more details), 1.55 Å
SCOPe Domain Sequences for d5c2ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c2ub_ b.1.1.0 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} vqlqesggglvqpggslrlscvvsgdyyaigwfrqapgkeregvaaissrdgstyypdav kgrftisrdnakntvylqmnslkpedtavyycaadrrqrwgpyyylsaleyvywgqgtqv tvss
Timeline for d5c2ub_: