Lineage for d2pooa_ (2poo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808366Superfamily b.68.3: Thermostable phytase (3-phytase) [50956] (1 family) (S)
    automatically mapped to Pfam PF02333
  5. 2808367Family b.68.3.1: Thermostable phytase (3-phytase) [50957] (2 proteins)
  6. 2808368Protein Thermostable phytase (3-phytase) [50958] (1 species)
  7. 2808369Species Bacillus amyloliquefaciens [TaxId:1390] [50959] (5 PDB entries)
  8. 2808373Domain d2pooa_: 2poo A: [27626]
    complexed with ca

Details for d2pooa_

PDB Entry: 2poo (more details), 2.05 Å

PDB Description: thermostable phytase in fully calcium loaded state
PDB Compounds: (A:) protein (phytase)

SCOPe Domain Sequences for d2pooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pooa_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}
klsdpyhftvnaaaetepvdtagdaaddpaiwldpknpqnsklittnkksglavyslegk
mlhsyhtgklnnvdirydfplngkkvdiaaasnrsegkntieiyaidgkngtlqsitdpn
rpiasaidevygfslyhsqktgkyyamvtgkegefeqyelnadkngyisgkkvrafkmns
qtegmaaddeygslyiaeedeaiwkfsaepdggsngtvidradgrhltpdiegltiyyaa
dgkgyllassqgnssyaiyerqgqnkyvadfqitdgpetdgtsdtdgidvlgfglgpeyp
fglfvaqdgenidhgqkanqnfkmvpweriadkigfhpqvnkqvdprkmtdrs

SCOPe Domain Coordinates for d2pooa_:

Click to download the PDB-style file with coordinates for d2pooa_.
(The format of our PDB-style files is described here.)

Timeline for d2pooa_: