Lineage for d5ac1a_ (5ac1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140678Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species)
  7. 2140918Species Sheep (Ovis aries) [TaxId:9940] [53727] (3 PDB entries)
  8. 2140925Domain d5ac1a_: 5ac1 A: [276257]
    automated match to d1bxsa_
    complexed with k9p, mg, txe

Details for d5ac1a_

PDB Entry: 5ac1 (more details), 2.1 Å

PDB Description: sheep aldehyde dehydrogenase 1a1 with duocarmycin analog inhibitor
PDB Compounds: (A:) Retinal dehydrogenase 1

SCOPe Domain Sequences for d5ac1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ac1a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]}
dvpapltnlqfkytkifinnewhssvsgkkfpvfnpateeklceveegdkedvdkavkaa
rqafqigspwrtmdasergrllnkladlierdrlllatmeamnggklfsnaylmdlggci
ktlrycagwadkiqgrtipmdgnfftytrsepvgvcgqiipwnfpllmflwkigpalscg
ntvvvkpaeqtpltalhmgslikeagfppgvvnivpgygptagaaisshmdvdkvaftgs
tevgklikeaagksnlkrvslelggkspcivfadadldnavefahqgvfyhqgqcciaas
rlfveesiydefvrrsverakkyvlgnpltpgvsqgpqidkeqyekildliesgkkegak
lecgggpwgnkgyfiqptvfsdvtddmriakeeifgpvqqimkfkslddvikranntfyg
lsagiftndidkaitvssalqsgtvwvncysvvsaqcpfggfkmsgngrelgeygfheyt
evktvtikisqkns

SCOPe Domain Coordinates for d5ac1a_:

Click to download the PDB-style file with coordinates for d5ac1a_.
(The format of our PDB-style files is described here.)

Timeline for d5ac1a_: